PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco025594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 156aa    MW: 18242.9 Da    PI: 10.0693
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco025594.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.2e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien +nrqvt+skRr+gi+KKA+EL vLCda+v++i+fsst+k+ ey+s
  Aco025594.1  9 KKIENPTNRQVTYSKRRTGIMKKAKELTVLCDADVSLIMFSSTNKFSEYCS 59
                 68***********************************************96 PP

2K-box82.68.9e-2871154184
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                  yq+ sg +l++a++e++q+ l+ Lk+ ++nL++e+R+++Ge+L+ L++ eL+ Leq+L+++lk +R +K++++++q+++ +kk 
  Aco025594.1  71 YQQVSGINLWSAQYERMQNTLNHLKEINSNLRKEIRQRMGEELDGLDFYELRGLEQNLDEALKVVRHRKYHVITTQTDTYKKKV 154
                  7899999***************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.062161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-38295IPR002100Transcription factor, MADS-box
CDDcd002651.42E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-1982154IPR002487Transcription factor, K-box
PROSITE profilePS5129714.07284155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRGKIEIKK IENPTNRQVT YSKRRTGIMK KAKELTVLCD ADVSLIMFSS TNKFSEYCSP  60
STDTKKIFDR YQQVSGINLW SAQYERMQNT LNHLKEINSN LRKEIRQRMG EELDGLDFYE  120
LRGLEQNLDE ALKVVRHRKY HVITTQTDTY KKKVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18175173Myocyte-specific enhancer factor 2B
1tqe_Q2e-18175173Myocyte-specific enhancer factor 2B
1tqe_R2e-18175173Myocyte-specific enhancer factor 2B
1tqe_S2e-18175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9360440.0JN936044.1 Guzmania wittmackii x Guzmania lingulata cultivar Ostara MADS-box2 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781489.11e-102PREDICTED: MADS-box transcription factor 16 isoform X2
SwissprotQ944S99e-89MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLD0EW391e-110D0EW39_9POAL; MADS-box2 transcription factor
STRINGGSMUA_Achr9P20950_0017e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-61MIKC_MADS family protein